Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WNVGSSNRNKAENLLRGKRDGTFLVRES-SK-QGCYACSVVVDGEVKHCVMNKTATGYGFAEPYNLYSSLKELVLHY 4L23 Chain:B ((42-117)) WYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSD-PLTFSSVVELINHY

General information: TITO was launched using: RESULT: Template: 4L23.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 252 -12639 -50.15 -170.80 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain B : 0.73 3D Compatibility (PKB) : -50.15 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.752

(partial model without unconserved sides chains): PDB file : Tito_4L23.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4L23-query.scw PDB file : Tito_Scwrl_4L23.pdb: