Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPRTFPCPRCGEPSVWEGNEFRPFCSERCKLIDLGAWANDEYRLPTQDAPQQDKGSQHEDDYED 1OZB Chain:I ((2-25)) IGRNEPCP-CGS-----GKKYKHCHGSRVA----------------------------------

General information: TITO was launched using: RESULT: Template: 1OZB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain I - contact count / total energy / energy per contact / energy per residue : 56 -1368 -24.43 -57.00 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain I : 0.70 3D Compatibility (PKB) : -24.43 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.692

(partial model without unconserved sides chains): PDB file : Tito_1OZB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1OZB-query.scw PDB file : Tito_Scwrl_1OZB.pdb: