Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMDDLPHSSWIPTGQGSSSMNTMTKNKLFG---LADDRTDVWATP-QDFFEKLDRVFKFDLDVCALPDNAKCERFFTP-EIDGLKQEWTGTCWMNPPYGKEIIDWVAK-AADTASKGHTVVALV-PVRTDARWFQDYCL---GREIHFIRGRLKFGGSKTNAPF-GCCVVV-FRPS-----LVDVNWEKSA----
2DG5 Chain:B ((1-190))---TTHYSVV-DKDGNAVAVTYTLNTTFGTGIVAGESGILLNNQMDDFSAKPGVPNVYGLVGGDANAVGPNKRPLSSMSPTIVVKDGKTWLVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLPDELRVEKGFSPDTLKLLEAKGQKVALKEAMGSTQSIMVGPDGELYGASDPRSVDDLTAGY


General information:
TITO was launched using:
RESULT:

Template: 2DG5.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 701 28955 41.31 171.33
target 2D structure prediction score : 0.44
Monomeric hydrophicity matching model chain B : 0.62

3D Compatibility (PKB) : 41.31
2D Compatibility (Sec. Struct. Predict.) : 0.44
1D Compatibility (Hydrophobicity) : 0.62
QMean score : 0.078

(partial model without unconserved sides chains):
PDB file : Tito_2DG5.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2DG5-query.scw
PDB file : Tito_Scwrl_2DG5.pdb: