Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------------EWCTVTVFYQGRTSGYPLPTA-----KKVGIVQSFPGEGKGYADYQYILDENCDW-----KEHGRPWLTGMRLETVP-FVAKQKYE----------------------
1K2Y Chain:X ((5-154))KAPTLPASIFRAYDIRGVVGDTLTAETAYWIGRAIGSESLARGEPCVAVGRDGRLSGPELVKQLIQGLVDCGCQVSDVGMVPTPVLYYAANVLEGKSGVMLTGAHNPPDYNGFKIVVAGETLANEQIQALRERIEKNDLASGVGSVEQVD


General information:
TITO was launched using:
RESULT:

Template: 1K2Y.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 236 17096 72.44 227.94
target 2D structure prediction score : 0.65
Monomeric hydrophicity matching model chain X : 0.56

3D Compatibility (PKB) : 72.44
2D Compatibility (Sec. Struct. Predict.) : 0.65
1D Compatibility (Hydrophobicity) : 0.56
QMean score : -0.016

(partial model without unconserved sides chains):
PDB file : Tito_1K2Y.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1K2Y-query.scw
PDB file : Tito_Scwrl_1K2Y.pdb: