Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ICDIVIRF-EGAVVETGTMGPST---------AKTFNLI-TDQISITV-DHNCNITHWTQVEKFTVSSTLRNPPAAAAARR---- 1GG3 Chain:A ((1-81)) -MHCKVSLLDDTVYEC-VVEKHAKGQDLLKRVCEHLNLLEEDYFGLAIWDNA-TSKTWLDSAK-EIKKQVRGVPWNFTFNVKFYP

General information: TITO was launched using: RESULT: Template: 1GG3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 214 -9285 -43.39 -142.85 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -43.39 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.338

(partial model without unconserved sides chains): PDB file : Tito_1GG3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1GG3-query.scw PDB file : Tito_Scwrl_1GG3.pdb: