Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCI-GQRRFHTMDELVEHY 4H34 Chain:A ((27-150)) WFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYY

General information: TITO was launched using: RESULT: Template: 4H34.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 283 -17282 -61.07 -230.43 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.79 3D Compatibility (PKB) : -61.07 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.79 QMean score : 0.553

(partial model without unconserved sides chains): PDB file : Tito_4H34.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4H34-query.scw PDB file : Tito_Scwrl_4H34.pdb: