Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHY 4U5W Chain:D ((74-156)) WFFKGISRKDAERQLLAPGNMLGSFMIRD-----GSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHY

General information: TITO was launched using: RESULT: Template: 4U5W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 273 -41681 -152.68 -534.37 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain D : 0.93 3D Compatibility (PKB) : -152.68 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.93 QMean score : 0.792

(partial model without unconserved sides chains): PDB file : Tito_4U5W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4U5W-query.scw PDB file : Tito_Scwrl_4U5W.pdb: