Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKIILASAMSGVVLLLGACATTPKNTLAIQKENNQFEVTGI-GKTNLIAKNNAVTAAQKTCSKSTTPVIVDEKTSYHGVLKDVVSEKTGQMVEAAAGVIGTLTGKNASLAKDDDYQTTLTFYCKIN 3ONR Chain:C ((9-43)) -------------------------------------DIIGTSPTSWEQAAAEAVQRARDSVDDI-RVARVIE------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3ONR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 57 2985 52.37 87.79 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain C : 0.54 3D Compatibility (PKB) : 52.37 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.657

(partial model without unconserved sides chains): PDB file : Tito_3ONR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ONR-query.scw PDB file : Tito_Scwrl_3ONR.pdb: