Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKITTAIVLSMSGLIATTAMAAPHDHYHHQGYETKTVKVIHKDDHANIWRAGQVVPHQYQHPRYVI-DYRSHQKLTKPGRYQKWYKVNGNYVLVNEREFGLSRI 2L1S Chain:A ((16-74)) ---------------------------------------------DFTQFHIGDTVPAMYLTPEYNIKQWQQR-NLPAPDAGSHWTYMGGNYVLITDTEGKILKV

General information: TITO was launched using: RESULT: Template: 2L1S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 198 -4482 -22.63 -77.27 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -22.63 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.512

(partial model without unconserved sides chains): PDB file : Tito_2L1S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2L1S-query.scw PDB file : Tito_Scwrl_2L1S.pdb: