Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNMDTIEAKKNLNALCNEIEKLQNLSRSLM------------TAKEMLDIDAKIKRHKDQVKNIRSNLHA-
2JS5 Chain:A ((1-71))MSEGAEELKAKLKKLNAQATALKMDLHDLAEDLPTGWNRIMEVAEKTYEAYRQLDEFRKSTASLEHHHHHH


General information:
TITO was launched using:
RESULT:

Template: 2JS5.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 108 7046 65.24 121.48
target 2D structure prediction score : 0.90
Monomeric hydrophicity matching model chain A : 0.66

3D Compatibility (PKB) : 65.24
2D Compatibility (Sec. Struct. Predict.) : 0.90
1D Compatibility (Hydrophobicity) : 0.66
QMean score : 0.678

(partial model without unconserved sides chains):
PDB file : Tito_2JS5.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2JS5-query.scw
PDB file : Tito_Scwrl_2JS5.pdb: