Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------WYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHY-----------------
1AOU Chain:F ((1-106))SIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLSSRLVVPSHK


General information:
TITO was launched using:
RESULT:

Template: 1AOU.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 322 38302 118.95 461.46
target 2D structure prediction score : 0.55
Monomeric hydrophicity matching model chain F : 0.88

3D Compatibility (PKB) : 118.95
2D Compatibility (Sec. Struct. Predict.) : 0.55
1D Compatibility (Hydrophobicity) : 0.88
QMean score : 0.496

(partial model without unconserved sides chains):
PDB file : Tito_1AOU.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1AOU-query.scw
PDB file : Tito_Scwrl_1AOU.pdb: