Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPSDTTGKPSGTTVDPSKPDYSAPRYWIDKCIVQLLDATTE---EIVMERFSSGFGMWDSVSYLGHTYQFRLDQDCKTIWGDSRGSIHPSVKFRKVRARVNMHTRKLDPLYVVD 1MP1 Chain:A ((35-78)) ----------EKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVK------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1MP1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 77 -8886 -115.40 -216.73 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -115.40 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.397

(partial model without unconserved sides chains): PDB file : Tito_1MP1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1MP1-query.scw PDB file : Tito_Scwrl_1MP1.pdb: