Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----------------------------------------------------------------GCPYSVRRYDKEVKWDIVEA--GKSHIRVIDGYPATISADQDCKLKIKGLARLKYT--------IAPGD------SRPD---------RCKGNSIGTS----------------------------------------- 1II2 Chain:A ((1-199)) PPTIHRNLLSPELVQWALKIEKDSRLTARGALAVMSYAKTGRSPLDKRIVDTDDVRENVDWGKVNMKLSEESFAR-VRKIAKEFLDTREHLFVVDCF---AGHDERYRLKVRVFTTRPYHALFMRDMLIVPTPEELATFGEPDYVIYNAGECKADPSIPGLTSTTCVALNFKTREQVILGTEYAGEMKKGILTVMFELMPQMN

General information: TITO was launched using: RESULT: Template: 1II2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 110 4727 42.97 68.51 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : 42.97 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.222

(partial model without unconserved sides chains): PDB file : Tito_1II2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1II2-query.scw PDB file : Tito_Scwrl_1II2.pdb: