Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----MSNIYDSANELSRGLRG------------LPEYKAVKAAKDAIAADAEASKIFTEYLAFQEEIQK---------LAQTGQMPDASFQAKMEGFGKQIQGNSLLSEFFTKQQQLAIYLSDIEKIVFEPVSELLK-------
1V7M Chain:V ((7-151))CDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLC


General information:
TITO was launched using:
RESULT:

Template: 1V7M.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain V - contact count / total energy / energy per contact / energy per residue : 298 21980 73.76 196.25
target 2D structure prediction score : 0.54
Monomeric hydrophicity matching model chain V : 0.63

3D Compatibility (PKB) : 73.76
2D Compatibility (Sec. Struct. Predict.) : 0.54
1D Compatibility (Hydrophobicity) : 0.63
QMean score : 0.330

(partial model without unconserved sides chains):
PDB file : Tito_1V7M.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1V7M-query.scw
PDB file : Tito_Scwrl_1V7M.pdb: