Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------MATAIENRARQLKNAKRGGYAPTIAKDVNKHKV----QKIRRALDEARRYVSELNDETVIFDDQDARQKAEGAKAIIEMFEAALSGA-------
1HX1 Chain:B ((1-112))GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE


General information:
TITO was launched using:
RESULT:

Template: 1HX1.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 134 10156 75.79 122.36
target 2D structure prediction score : 0.77
Monomeric hydrophicity matching model chain B : 0.71

3D Compatibility (PKB) : 75.79
2D Compatibility (Sec. Struct. Predict.) : 0.77
1D Compatibility (Hydrophobicity) : 0.71
QMean score : 0.628

(partial model without unconserved sides chains):
PDB file : Tito_1HX1.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1HX1-query.scw
PDB file : Tito_Scwrl_1HX1.pdb: