Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MALYEIPLLDRNQKFFIKLNKVNYQLKLVYLKRW--YLDIYQANAEPIARSIPLVSGIDILSPYSHLINGSMYVQNLNEDESQSFNDLGTNIKLFWQDPE 1X2I Chain:A ((2-69)) ----ALTLAERQRLIVEGLPHVSATLARRLLKHFGSVERVFTASVAELMK----VEGI-----------GEKIAKEIRRVITAPYIE-------------

General information: TITO was launched using: RESULT: Template: 1X2I.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 212 4086 19.27 61.91 target 2D structure prediction score : 0.30 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : 19.27 2D Compatibility (Sec. Struct. Predict.) : 0.30 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.321

(partial model without unconserved sides chains): PDB file : Tito_1X2I.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1X2I-query.scw PDB file : Tito_Scwrl_1X2I.pdb: