Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------GRRVPVKRPQSRTRAPDPPKEDRKPISCVVKMCESVGDGKRSKVRCIERQKLYPGGSHTFQEDGKN---------SITVSLDGNCNKSLSGRTNNPRIGFVVEKLYRPEDPLLAAIS--KYFEPPRAPHYQ
3C12 Chain:A ((50-187))DQVLKGAALVGHNVLVPSAQVAIDATGSAKGVVAATS-AGFVNFEITDANGTFVKQLSVPAS-AAGEVSFAWDGTDANGNRMAAGKYGITATQTDTAG-AKSKLATYVDAPVDSVTIGSDGLYLNLTGLGTSPLANVLRVS


General information:
TITO was launched using:
RESULT:

Template: 3C12.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 465 14353 30.87 122.68
target 2D structure prediction score : 0.34
Monomeric hydrophicity matching model chain A : 0.65

3D Compatibility (PKB) : 30.87
2D Compatibility (Sec. Struct. Predict.) : 0.34
1D Compatibility (Hydrophobicity) : 0.65
QMean score : 0.253

(partial model without unconserved sides chains):
PDB file : Tito_3C12.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3C12-query.scw
PDB file : Tito_Scwrl_3C12.pdb: