Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --KCVIKRVFSDGSSVKIPAQPAQS----------TTISKQAVWVYGNCQPFP--VVLNDGSKLSGEIETPAVTPVESVDEDDCFELDISGQR--------- 1RKI Chain:A ((1-101)) MKKHIIIKTIP-KKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

General information: TITO was launched using: RESULT: Template: 1RKI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 308 10777 34.99 138.17 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 34.99 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.346

(partial model without unconserved sides chains): PDB file : Tito_1RKI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1RKI-query.scw PDB file : Tito_Scwrl_1RKI.pdb: