Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGFITRRVRPPLSVTHREAERLLEP--KPQGCYLVRFSESA-VTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDSAHARLQDLLLHY 1RJA Chain:A ((4-81)) WFFGCISR----------SEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHL-NEAVSFLSLPELVNYH

General information: TITO was launched using: RESULT: Template: 1RJA.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 283 -5617 -19.85 -74.89 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -19.85 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.485

(partial model without unconserved sides chains): PDB file : Tito_1RJA.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1RJA-query.scw PDB file : Tito_Scwrl_1RJA.pdb: