Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAVRGLQLGIKTRTWQGAATGAAGGAILGGVAYAATCWW 2D0S Chain:A ((56-72)) ----PMPPHPQVAEADIEKIV-------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2D0S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 8 -2549 -318.63 -149.94 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.47 3D Compatibility (PKB) : -318.63 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.47 QMean score : 0.410

(partial model without unconserved sides chains): PDB file : Tito_2D0S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2D0S-query.scw PDB file : Tito_Scwrl_2D0S.pdb: