Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLNLQFAETMELTEAELQD-VRGGNLVNSMGGGGRSGISGWGVPGIYPGWGNQGMSPNRGAFDWTIDLADGLFGRRRR 3DD7 Chain:D ((1-22)) ALDAEFASLFDTLDSTNKEMVN--------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3DD7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 11 -1654 -150.32 -78.74 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain D : 0.56 3D Compatibility (PKB) : -150.32 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.628

(partial model without unconserved sides chains): PDB file : Tito_3DD7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3DD7-query.scw PDB file : Tito_Scwrl_3DD7.pdb: