Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKCKKYEEFGLDSLLQETRGGRNHAYMTVEEEKAFLARHLKATEAGEFVTIDALFQAYKKKLGRSYTRDAFYQLLKRHGWRNIMPRPEHPKKADAQTIVASKNKISIQEDKKAL 5FD5 Chain:B ((34-63)) -----------------------------------------------DHPDVEELYRRSVKV-DAKISISTVYRTVKL-------------------------------------

General information: TITO was launched using: RESULT: Template: 5FD5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 55 -12261 -222.92 -408.68 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain B : 0.62 3D Compatibility (PKB) : -222.92 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.893

(partial model without unconserved sides chains): PDB file : Tito_5FD5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5FD5-query.scw PDB file : Tito_Scwrl_5FD5.pdb: