Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLKKYFSKYKWTDLFWILFVILTCLYIGNHDL------------FTLNHQEFSFRGSVWGLVLALYHLLFIDKFVISNRK 2KSE Chain:A ((1-186)) MGKFTQRLSLRVRLTLIFLILASVTWLLSSFVAWKQTTDNWEYREDMALAIVAGQLIPWLVALPIMLIIMMVLL---GRE

General information: TITO was launched using: RESULT: Template: 2KSE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 98 -19592 -199.91 -301.41 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -199.91 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.052

(partial model without unconserved sides chains): PDB file : Tito_2KSE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2KSE-query.scw PDB file : Tito_Scwrl_2KSE.pdb: