Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGTAMNVKNQAQDRQQILIDLYKQYLLSEITLGQLLSYLRKNVLGLSQEQYANLVGISRRTLTDIEQDKGKLTQSVLDKVFKPLGLKAGLVPTHEHIVSKIIKPNE 3F6W Chain:A ((14-79)) ------------------------------ALLDLLLEARSA-AGITQKELAARLGRPQSFVSKTENAERRLDVIEFMDFCRGIGTDPYALLSKLEA---------

General information: TITO was launched using: RESULT: Template: 3F6W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 206 -27649 -134.22 -418.92 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -134.22 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.737

(partial model without unconserved sides chains): PDB file : Tito_3F6W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3F6W-query.scw PDB file : Tito_Scwrl_3F6W.pdb: