Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------------MTDLNKKREVNLSFEQDD--GAVWVFDGDSHQGTEISHLMMMHSDEYNEDELRVICNHAAFEIDRLRAELEKSKAQAVPEAQQKLTDTYF-------WEGSDYVVDCPFEYDIEL-------DKGEVLELQKWQRTES-------TKVYFANIYKDEDNFEILQFASKAEAENAVAENLKFLEASESGAEG
5FT3 Chain:B ((1-221))MTKLILYTLHVSPPCRAVELCAKALGLELEQKTVNLLTKEHLTPEFMKMNPQHTVPVLDDNGTIVCESHAIMIYLVSKYGKDD--SLYSKELVKQAKLNAALHFESGVLFARLRFVCEPILFAGGSEIPADRAEYVQKAYQLLEDTLVDDYIVGNSLTIADFSCVSSVSSIMGVIPMDKEKFPKIYGWLDRLKALPYYEAANGSGAEQVAQFVLSQKEKNAQK


General information:
TITO was launched using:
RESULT:

Template: 5FT3.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 711 36157 50.85 217.81
target 2D structure prediction score : 0.46
Monomeric hydrophicity matching model chain B : 0.61

3D Compatibility (PKB) : 50.85
2D Compatibility (Sec. Struct. Predict.) : 0.46
1D Compatibility (Hydrophobicity) : 0.61
QMean score : 0.190

(partial model without unconserved sides chains):
PDB file : Tito_5FT3.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5FT3-query.scw
PDB file : Tito_Scwrl_5FT3.pdb: