Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSVSRIIFAYFPTTAISYKLFATKRGVVTKFCHNPSFLINGVQ 1F93 Chain:E ((1-31)) -MVSKL-----------SQLQTELLAALLESGLSKEALIQALG

General information: TITO was launched using: RESULT: Template: 1F93.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 28 -5223 -186.52 -168.47 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain E : 0.57 3D Compatibility (PKB) : -186.52 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.204

(partial model without unconserved sides chains): PDB file : Tito_1F93.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1F93-query.scw PDB file : Tito_Scwrl_1F93.pdb: