Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGYDKHQARTSGWR-VPENNLIFVSLLGGGLGGLISRKVFHHKTRKKKFTIGFAAGVLVDLILIYFFH 1T0F Chain:C ((4-52)) ----IKVVKPSDWDSLPDTDLRYIYSQRQ------PEKTMHERLKGK--------GVIVDMASLFKQ-

General information: TITO was launched using: RESULT: Template: 1T0F.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 90 -3036 -33.73 -63.24 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain C : 0.64 3D Compatibility (PKB) : -33.73 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.311

(partial model without unconserved sides chains): PDB file : Tito_1T0F.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1T0F-query.scw PDB file : Tito_Scwrl_1T0F.pdb: