Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTG-YSFKFG------FNEFSSLKDFVKHF 1D4T Chain:A ((6-87)) VYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAF

General information: TITO was launched using: RESULT: Template: 1D4T.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 243 -24839 -102.22 -331.18 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.78 3D Compatibility (PKB) : -102.22 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.692

(partial model without unconserved sides chains): PDB file : Tito_1D4T.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1D4T-query.scw PDB file : Tito_Scwrl_1D4T.pdb: