Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRMLPILLLFLALLPFFSKFVTGGSSFSWEVFLIFIIDWVLLIVFAIQISYIFWRLSQKWKELSNK 2RMZ Chain:A ((699-726)) ----------------------------------SVMGAILLIGLAALLIWKLLITIHDRKE----

General information: TITO was launched using: RESULT: Template: 2RMZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 3 592 197.17 21.13 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain A : 0.46 3D Compatibility (PKB) : 197.17 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.46 QMean score : 0.506

(partial model without unconserved sides chains): PDB file : Tito_2RMZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2RMZ-query.scw PDB file : Tito_Scwrl_2RMZ.pdb: