Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIFLIRMIYNAVDIYSLILVAFAVMSWFPGAYESSLGRWIVALVKPVLAPLQRLPLQIAGLDLSVWVAIVLVRFLGENLVRFLAMIG 2VDC Chain:B ((487-517)) -----------------------VLSDKYRGLHHFFRQNFSQVTNPPIDSLRER---------------------------------

General information: TITO was launched using: RESULT: Template: 2VDC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 18 -1643 -91.25 -52.98 target 2D structure prediction score : 0.13 Monomeric hydrophicity matching model chain B : 0.43 3D Compatibility (PKB) : -91.25 2D Compatibility (Sec. Struct. Predict.) : 0.13 1D Compatibility (Hydrophobicity) : 0.43 QMean score : 0.123

(partial model without unconserved sides chains): PDB file : Tito_2VDC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2VDC-query.scw PDB file : Tito_Scwrl_2VDC.pdb: