Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSIQQLKELFGNQEAVLELVQLEGGELALRNAGSAKEPLVKIQFSDELKAILGEQTPIVAQHMIQAALFGLLEKQVNEWQAEVVDEQPKFLS 5M3Q Chain:A ((147-204)) ---------------------LVGSYMALSNQGGLVHPKTSIQDQDELSSLLG--VPLVAGSVNRGSNVIGGGMVVNDWLA-----------

General information: TITO was launched using: RESULT: Template: 5M3Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 203 -13362 -65.82 -230.38 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -65.82 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.075

(partial model without unconserved sides chains): PDB file : Tito_5M3Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5M3Q-query.scw PDB file : Tito_Scwrl_5M3Q.pdb: