Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence LCTTIQKGQIFRNILTCMSEFYIKEEFSYTVCNGKNYASPNRTILCIWEGHIIHVRLDERCNWTRLEGDQTEELESQNVEFKVLQKCVASKYKLDPPHAWDAGHGVKLG 4P2L Chain:A ((429-485)) --------------------------------------SPSNAVLWLWTSH-------NRVN-ARLSGALSEDPQFPKVQWPPRELCSACHNEVNGVPLWDLG------

General information: TITO was launched using: RESULT: Template: 4P2L.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 100 7831 78.31 137.38 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 78.31 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.149

(partial model without unconserved sides chains): PDB file : Tito_4P2L.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4P2L-query.scw PDB file : Tito_Scwrl_4P2L.pdb: