Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WPLTADCNIYPKIGDKSVGWGSGFMGSVAHVRIEKVDYA---VALWKRVCKAVKLEELPPGVELFAEPNTLRR-NPQPVQRRGLVGREPLGGLELQE 2ZF4 Chain:A ((81-138)) ---------------------------------QKVAYGRERTALGEQLCERPLDDETGPFAELFLPRDVLRRLGARHIGRRVVLGREADG------

General information: TITO was launched using: RESULT: Template: 2ZF4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 51 3753 73.59 69.50 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : 73.59 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.316

(partial model without unconserved sides chains): PDB file : Tito_2ZF4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ZF4-query.scw PDB file : Tito_Scwrl_2ZF4.pdb: