Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV 4ZCK Chain:A ((111-154)) ------------------VSRPKVIFREIDGRKQEPYENVTLDVEEQHQGSVMQALGERKG---------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4ZCK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 43 -2026 -47.10 -47.10 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -47.10 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.543

(partial model without unconserved sides chains): PDB file : Tito_4ZCK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4ZCK-query.scw PDB file : Tito_Scwrl_4ZCK.pdb: