Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence CYGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCY 5IXI Chain:A ((422-506)) CHGPICTEYAINKLRQE------YVLRWSCTDFDNILMT------------NFQI-EVQKGRYSLHGSDRSFPSLGDLMS--

General information: TITO was launched using: RESULT: Template: 5IXI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 205 -33598 -163.89 -550.78 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.77 3D Compatibility (PKB) : -163.89 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.551

(partial model without unconserved sides chains): PDB file : Tito_5IXI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5IXI-query.scw PDB file : Tito_Scwrl_5IXI.pdb: