Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNH 2EOB Chain:A ((21-92)) WYYDRLSRGEAEDMLMRIPRDGAFLIRKREGTDS-----YAITFRARGKVKHCRINRDGRHFVLGTSA----YFESLVELV---

General information: TITO was launched using: RESULT: Template: 2EOB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 238 -46186 -194.06 -641.47 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.76 3D Compatibility (PKB) : -194.06 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.76 QMean score : 0.634

(partial model without unconserved sides chains): PDB file : Tito_2EOB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2EOB-query.scw PDB file : Tito_Scwrl_2EOB.pdb: