Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHY 1Z3K Chain:A ((3-77)) WYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHY

General information: TITO was launched using: RESULT: Template: 1Z3K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 275 -15890 -57.78 -211.87 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.94 3D Compatibility (PKB) : -57.78 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.94 QMean score : 0.444

(partial model without unconserved sides chains): PDB file : Tito_1Z3K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Z3K-query.scw PDB file : Tito_Scwrl_1Z3K.pdb: