Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGPISRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTERGQCRVQHLHFPSVVDMLHHF 1RQQ Chain:C ((13-90)) WFHGTLSRVKAAQLVLAGGPRSHGLFVIRQSETRPGECVLTFNFQGKAKHLRLSLN--GQCHVQHLWFQSVFDMLRHF

General information: TITO was launched using: RESULT: Template: 1RQQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 262 -42423 -161.92 -558.20 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain C : 0.92 3D Compatibility (PKB) : -161.92 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.92 QMean score : 0.683

(partial model without unconserved sides chains): PDB file : Tito_1RQQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1RQQ-query.scw PDB file : Tito_Scwrl_1RQQ.pdb: