Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSKNIVQLNNSFIQNEYQRRRYLMKERQKRNRFMGGVLILIMLLFILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKLKDEDYAAKYTRAKYYYSKSREKVYTIPDLLQR 4OYU Chain:A ((87-143)) --ENMTELLSSGLKNDYNKETFTLKHKIDEQMFPCRFIKIVPLLSWGPSFNFSIWYVEL---------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4OYU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 87 -14640 -168.27 -256.83 target 2D structure prediction score : 0.11 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -168.27 2D Compatibility (Sec. Struct. Predict.) : 0.11 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.282

(partial model without unconserved sides chains): PDB file : Tito_4OYU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4OYU-query.scw PDB file : Tito_Scwrl_4OYU.pdb: