Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTEKEIFDRIVTIIQER-QGEDFVVTESLSLKDDLDADSVDLMEFILTLEDEFSIEISDEEIDQLQNVGDVVKIIQGK
2N50 Chain:A ((1-75))MTREEVLQKVAKIISNHFDIEADQVTDQLNIKDDLNADSISVMEFVLELEDEFGTEISDEDAEKIETVGAAVDYI---


General information:
TITO was launched using:
RESULT:

Template: 2N50.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 244 11764 48.21 158.97
target 2D structure prediction score : 0.64
Monomeric hydrophicity matching model chain A : 0.87

3D Compatibility (PKB) : 48.21
2D Compatibility (Sec. Struct. Predict.) : 0.64
1D Compatibility (Hydrophobicity) : 0.87
QMean score : 0.510

(partial model without unconserved sides chains):
PDB file : Tito_2N50.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2N50-query.scw
PDB file : Tito_Scwrl_2N50.pdb: