Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKQFQLRRRKQMELVLPNNYVVIDEEEMMYLDGGAYLSKRACQGICVALAMSPGIFIALAGAAVLTKKLINYIKVGGLGGWLIGAAAGVLATAAGKIAYCIGYGALNRGCDISGNPYPWDGFISATVR 3R10 Chain:A ((242-323)) --------------------VVADESVFDAKDAERVIDEQACNMINIKLAKTGGIL-----EAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLD---------------------

General information: TITO was launched using: RESULT: Template: 3R10.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 342 -48463 -141.70 -591.01 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -141.70 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.165

(partial model without unconserved sides chains): PDB file : Tito_3R10.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3R10-query.scw PDB file : Tito_Scwrl_3R10.pdb: