Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MHLTHREVRDKLLSYSEGLQVYYELYQLLLFHFQEKNADHFFGLIEQELPTVHPLFQTVFWTFLRDRDKIINALKLPYSNAKLEATNNLIKVIKRKAFGFRNFNNFKKRILMTLNIKKESTNFVLSRL 5L4K Chain:S ((295-326)) ----------------------------------------------------------------------IKAIQLEYSEARRTMTNALRKAPQHTAVGFKQ--------------------------

General information: TITO was launched using: RESULT: Template: 5L4K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain S - contact count / total energy / energy per contact / energy per residue : 40 1332 33.30 41.63 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain S : 0.57 3D Compatibility (PKB) : 33.30 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.302

(partial model without unconserved sides chains): PDB file : Tito_5L4K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5L4K-query.scw PDB file : Tito_Scwrl_5L4K.pdb: