Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAKKSMVAREAKRQKIVDRYAEKRAALKA------AGDYE------GLSKLPRNASPTRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW
5UZ4 Chain:N ((2-99))-AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKA--


General information:
TITO was launched using:
RESULT:

Template: 5UZ4.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain N - contact count / total energy / energy per contact / energy per residue : 237 17155 72.38 199.48
target 2D structure prediction score : 0.60
Monomeric hydrophicity matching model chain N : 0.79

3D Compatibility (PKB) : 72.38
2D Compatibility (Sec. Struct. Predict.) : 0.60
1D Compatibility (Hydrophobicity) : 0.79
QMean score : 0.499

(partial model without unconserved sides chains):
PDB file : Tito_5UZ4.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5UZ4-query.scw
PDB file : Tito_Scwrl_5UZ4.pdb: