Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKQERFPLVSDDEVMLTEMPVMNLYDESDLISNIKGEYRDKNYLEWAPIAEEKPVKPIEKQVEKPKKAPLGVKKEGKSYAEVAREEARADLKKKRSANYLTQDFSLARRHSQPSLVRQGNQPTTPFQKENPGEFVKYSQKLTQSHYILAEEVHSIPTKNEEVSAPAPKKNNYDFLKKSQIYNKKSKQTEQERRVAQELNLTRMTE 2WJR Chain:A ((147-214)) --------------------------------------------------------------------------------------------------------------------------TTLYSKQNDYRYANHKKWATENAFVL--QYHMTPDITPYIE--------YDYLDRQGVYNGRDNLSENSYRIGVSFKL-----

General information: TITO was launched using: RESULT: Template: 2WJR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 221 19442 87.97 285.91 target 2D structure prediction score : 0.24 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : 87.97 2D Compatibility (Sec. Struct. Predict.) : 0.24 1D Compatibility (Hydrophobicity) : 0.65 QMean score : -0.082

(partial model without unconserved sides chains): PDB file : Tito_2WJR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2WJR-query.scw PDB file : Tito_Scwrl_2WJR.pdb: