Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)


Input alignment information:
Query sequenceMNFNHVYFGYDENR-PVLKDITCSIFKGQKIAFVGPSGSGKSTIVRLLEQFYKPLSGDILMEQSSIYDFNLKEWRSKIAWVSQNNAVLSGSIRDNLCLGLNRLVTDDELMKVLDLVSLGDEIRSMKEGLDTEVGERGRLLSGGAKPKTSNS
2ONJ Chain:A ((340-487))IDIDHVSFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENILLG-RPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLS--


General information:
TITO was launched using:
RESULT:

Template: 2ONJ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output 		Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 507 10781 21.26 73.34
target 2D structure prediction score : 0.60
Monomeric hydrophicity matching model chain A : 0.83

3D Compatibility (PKB) : 21.26
2D Compatibility (Sec. Struct. Predict.) : 0.60
1D Compatibility (Hydrophobicity) : 0.83
QMean score : 0.441

(partial model without unconserved sides chains):
PDB file : Tito_2ONJ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2ONJ-query.scw
PDB file : Tito_Scwrl_2ONJ.pdb: