Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKLEIINGQKIYGKRPILNQLNLVFQSGKIYGLKGDNGSSKTVLLKVLAGYIKLDKGKV-LQDGKVYGIKNHYIQDAGI--LIEKVEFLSHLSLREN----LELLRYFSSKVTEKRIAYWIQYYDLQEFEDVEYRHLSLGTKQKMALIQAFISSPSILFLDEPMNALDEKSVRLTKQVILSYLKKENGLVILTSHISEDISDLCTDVLVVENGHIQYVKDIQS
5X5Y Chain:B ((11-223))---------KSYKGRQVVRDVSMSIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGVVRIDEQNVTHLPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRSDLDRNGRKEALEGLLQEFHIHHIRDNLGMSLSGGERRRVEIARALASAPKFILLDEPFAGVDPISVGDIKQII-HHLKAKGIGILITDHNVRETLDICETAYIVNDGQLIAEGDAES


General information:
TITO was launched using:
RESULT:

Template: 5X5Y.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 959 3276 3.42 15.90
target 2D structure prediction score : 0.60
Monomeric hydrophicity matching model chain B : 0.75

3D Compatibility (PKB) : 3.42
2D Compatibility (Sec. Struct. Predict.) : 0.60
1D Compatibility (Hydrophobicity) : 0.75
QMean score : 0.479

(partial model without unconserved sides chains):
PDB file : Tito_5X5Y.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5X5Y-query.scw
PDB file : Tito_Scwrl_5X5Y.pdb: