Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKKLVFVCLGNICRSPMAEFVMKSM-----TDNYEIQSRATSSWEHGNPIHKGTQGIFQQYEIPYDKNKTSLQISKEDFEAFDYIIGMDASNISDLRQMCP-VDCQD-KIYSFSS---ESVPDPWYTGDFEETYRRVQEGCQAWLERLEKES
3ROF Chain:A ((6-154))MVDVAFVCLGNICRSPMAEAIMRQRLKDRNIHDIKVHSRGTGSWNLGEPPHEGTQKILNKHNIPFDGMISELFEATDD---FDYIVAMDQSNVDNIKSINPNLKGQLFKLLEFSNMEESDVPDPYYTNNFEGVYDMVLSSCDNLIDYIVKDA


General information:
TITO was launched using:
RESULT:

Template: 3ROF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 734 33122 45.12 238.28
target 2D structure prediction score : 0.72
Monomeric hydrophicity matching model chain A : 0.81

3D Compatibility (PKB) : 45.12
2D Compatibility (Sec. Struct. Predict.) : 0.72
1D Compatibility (Hydrophobicity) : 0.81
QMean score : 0.544

(partial model without unconserved sides chains):
PDB file : Tito_3ROF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3ROF-query.scw
PDB file : Tito_Scwrl_3ROF.pdb: