Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVMSLITHRRFISCNENIKHYKRLIDKAEKCVNDLMAELNSVITTVTGIGNRLGAVILAEIQNIHAFDNPAQLQAFAGLDSSIYQSGQIDLAGRMIKRGSPHLR 4BY9 Chain:F ((219-277)) --------EVVRQLAEEIDRLYQLRKKLEDYIDRAMDDVAPNLKAL--VGAKLAARLISLAGGLRELAM-----------------------------------

General information: TITO was launched using: RESULT: Template: 4BY9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 100 -2923 -29.23 -49.53 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain F : 0.62 3D Compatibility (PKB) : -29.23 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.378

(partial model without unconserved sides chains): PDB file : Tito_4BY9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4BY9-query.scw PDB file : Tito_Scwrl_4BY9.pdb: