Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MQIYLNGELTDTPS-QNLLQLIQELALEGKRFAVEHNQQIVPKSKLEQISIAQHDRIEIIHAVGGG 1F0Z Chain:A ((1-66)) MQILFNDQAMQCAAGQTVHELLEQLDQRQAGAALAINQQIVPREQWAQHIVQDGDQILLFQVIAGG

General information: TITO was launched using: RESULT: Template: 1F0Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 291 -4457 -15.32 -68.57 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.80 3D Compatibility (PKB) : -15.32 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.393

(partial model without unconserved sides chains): PDB file : Tito_1F0Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1F0Z-query.scw PDB file : Tito_Scwrl_1F0Z.pdb: