Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTAREQGVVKWFNDTKGFGFIQRNGGDDVFVHFRAIVGDGHRSLRDGQRVEFSVVQGQKGFQAENVQPLD 1I5F Chain:A ((2-66)) ----QEGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL-

General information: TITO was launched using: RESULT: Template: 1I5F.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 276 -36355 -131.72 -559.31 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.84 3D Compatibility (PKB) : -131.72 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.677

(partial model without unconserved sides chains): PDB file : Tito_1I5F.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1I5F-query.scw PDB file : Tito_Scwrl_1I5F.pdb: